• Gene id: 284805

Gene Summary

• Gene Symbol: C20orf203   Gene   UCSC   Ensembl
• Gene name: chromosome 20 open reading frame 203
• Alternate names: uncharacterized protein C20orf203, alugen,
• Gene location: 20q11.21 (32673940: 32631624)     Exons: 6     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is thought to be a human-specific protein. Currently available evidence suggests that orthologous regions in other organisms contain sequence differences that would not support production of a protein product. Genome-wide
• OMIM: 606683

Protein Summary

• Protein general information: Q8NBC4  
  • Name: Uncharacterized protein C20orf203
  • Length: 194  
  • Mass: 21159
  • Tissue specificity: Expressed most abundantly in the brain at protein level. Present in cortex, cerebellum and midbrain. Found in neurons. Elevated expressions detected in Alzheimer brain samples. Also expressed in testis. {ECO
• Sequence:

  MFPRPVLNSRAQAILLPQPPNMLDHRQWPPRLASFPFTKTGMLSRATSVLAGLTAHLWDLGGGAGRRTSKAQRVH
  PQPSHQRQPPPPQHPGPYQERIWVGGEGWGEVGGLRLSKVGRRDREVGRGLRAPAGRGRAMGGMPRMGTVGDFGQ
  ALSSLAWTSTCFQDFCLPSLPGKLPAPLISKQQFLSNSSRSLFN

• Structural information:
  • Interpro: IPR040965  
• Other Databases: GeneCards:  C20orf203  Malacards:  C20orf203

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray