• Gene id: 284723

Gene Summary

• Gene Symbol: SLC25A34   Gene   UCSC   Ensembl
• Gene name: solute carrier family 25 member 34
• Alternate names: solute carrier family 25 member 34,
• Gene location: 1p36.21 (15735087: 15741391)     Exons: 6     NC_000001.11
• Gene summary(Entrez): SLC25A34 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]).[supplied by OMIM, Mar 2008]
• OMIM: 139392

Protein Summary

• Protein general information: Q6PIV7  
  • Name: Solute carrier family 25 member 34
  • Length: 304  
  • Mass: 32224
• Sequence:

  METVPPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGELQARGTYPRPYHGFIASVAAVARADGLWGLQKGLAA
  GLLYQGLMNGVRFYCYSLACQAGLTQQPGGTVVAGAVAGALGAFVGSPAYLIKTQLQAQTVAAVAVGHQHNHQTV
  LGALETIWRQQGLLGLWQGVGGAVPRVMVGSAAQLATFASAKAWVQKQQWLPEDSWLVALAGGMISSIAVVVVMT
  PFDVVSTRLYNQPVDTAGRGQLYGGLTDCMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAGRAQ
  HKGT

• Structural information:
  • Interpro: IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000294454
• Other Databases: GeneCards:  SLC25A34  Malacards:  SLC25A34

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0001835	blastocyst hatching	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq