• Gene id: 284485

Gene Summary

• Gene Symbol: RIIAD1   Gene   UCSC   Ensembl
• Aliases: C1orf230, NCRNA00166
• Gene name: regulatory subunit of type II PKA R-subunit domain containing 1
• Alternate names: RIIa domain-containing protein 1, RIIa domain-containing protein C1orf230, RIIa domain-containing protein ENSP00000357824, regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1,
• Gene location: 1q21.3 (151721521: 151729804)     Exons: 5     NC_000001.11
• OMIM: 0

Protein Summary

• Protein general information: A6NNX1  
  • Name: RIIa domain containing protein 1
  • Length: 92  
  • Mass: 10810
• Sequence:

  METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDP
  RLPNKIHMQLIKDKKAA

• Structural information:
  • Protein Domains: (43..7-)
    (/note="RIIa"-)
  • Interpro: IPR003117  
  • STRING: ENSP00000419249
• Other Databases: GeneCards:  RIIAD1  Malacards:  RIIAD1

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)