Search Result
| Gene id | 284366 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | KLK9 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | KLK-L3, KLKL3 | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | kallikrein related peptidase 9 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | kallikrein-9, kallikrein-like protein 3, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
19q13.41 (51009591: 51002507) Exons: 5 NC_000019.10 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is a kallikrein-related serine protease. This gene is activated by steroid hormones in a human breast cancer cell line, making it a good marker for cancer detection. The encoded protein is found primarily in the cytoplasm. |
||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 605504 | ||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9UKQ9 Name: Kallikrein 9 (EC 3.4.21. ) (Kallikrein like protein 3) (KLK L3) Length: 250 Mass: 27513 Tissue specificity: Skin, thymus, trachea, cerebellum and spinal cord. | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MKLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHCRKPYLWVRLGE HHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSPGMQCLISGWGA VSSPKALFPVTLQCANISILENKLCHWAYPGHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPC SRPRRPAVYTSVCHYLDWIQEIMEN | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: KLK9  Malacards: KLK9 | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||