• Gene id: 284266

Gene Summary

• Gene Symbol: SIGLEC15   Gene   UCSC   Ensembl
• Aliases: CD33L3, HsT1361, SIGLEC-15
• Gene name: sialic acid binding Ig like lectin 15
• Alternate names: sialic acid-binding Ig-like lectin 15, CD33 antigen-like 3, CD33 molecule-like 3,
• Gene location: 18q12.3 (45825674: 45844093)     Exons: 6     NC_000018.10
• OMIM: 618105

Protein Summary

• Protein general information: Q6ZMC9  
  • Name: Sialic acid binding Ig like lectin 15 (Siglec 15) (CD33 antigen like 3)
  • Length: 328  
  • Mass: 35653
  • Tissue specificity: Expressed in macrophage and/or dendritic cells of spleen and lymph nodes.
• Sequence:

  MEKSIWLLACLAWVLPTGSFVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDG
  PLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDV
  HDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAE
  LPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGASTVALLLGALGFKALLLLGVLAARAARRRPEHLDTPDTP
  PRSQAQESNYENLSQMNPRSPPATMCSP

• Structural information:
  • Protein Domains: (40..15-)
    (/note="Ig-like-V-type)
    (168..25-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106   IPR042836  
  • Prosite: PS50835
  • STRING: ENSP00000374125
• Other Databases: GeneCards:  SIGLEC15  Malacards:  SIGLEC15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001204	regulation of osteoclast development	IBA	biological process
GO:0045124	regulation of bone resorption	IBA	biological process
GO:0032956	regulation of actin cytoskeleton organization	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0045087	innate immune response	TAS	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0032956	regulation of actin cytoskeleton organization	IEA	biological process
GO:0045124	regulation of bone resorption	IEA	biological process
GO:2001204	regulation of osteoclast development	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq