• Gene id: 283999

Gene Summary

• Gene Symbol: TMEM235   Gene   UCSC   Ensembl
• Aliases: ARGM1
• Gene name: transmembrane protein 235
• Alternate names: transmembrane protein 235, transmembrane protein ENSP00000364084,
• Gene location: 17q25.3 (78231292: 78242848)     Exons: 9     NC_000017.11

Protein Summary

• Protein general information: A6NFC5  
  • Name: Transmembrane protein 235
  • Length: 223  
  • Mass: 23360
• Sequence:

  MARLGALLLAAALGALLSFALLAAAVASDYWYILEVADAGNGSAWPGRAELLSSHSGLWRICEGQNGCIPLVDPF
  ASESLDVSTSVQHLILLHRAVIVVLPLSLVLLVCGWICGLLSSLAQSVSLLLFTGCYFLLGSVLTLAGVSIYISY
  SHLAFAETVQQYGPQHMQGVRVSFGWSMALAWGSCALEAFSGTLLLSAAWTLSLSPPICGHLSPQQVGGRGGD

• Structural information:
  • Interpro: IPR004031  IPR039951  
  • STRING: ENSP00000402790
• Other Databases: GeneCards:  TMEM235  Malacards:  TMEM235

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016324	apical plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq