• Gene id: 283870

Gene Summary

• Gene Symbol: BRICD5   Gene   UCSC   Ensembl
• Aliases: C16orf79
• Gene name: BRICHOS domain containing 5
• Alternate names: BRICHOS domain-containing protein 5, BRICHOS domain-containing protein C16orf79,
• Gene location: 16p13.3 (2211067: 2209252)     Exons: 6     NC_000016.10
• OMIM: 611933

Protein Summary

• Protein general information: Q6PL45  
  • Name: BRICHOS domain containing protein 5
  • Length: 260  
  • Mass: 28486
• Sequence:

  MEPASCCAERPKPGPTGVKTKPSCGGWRAVSLLLLLLLLVLAAVGVVAGGLLGSAQGPPKPRLQTLRMTLPSPHM
  PRPNQTILVDVARNAATITVTPPQSNHSWAVLFDGQSGCICYRPEEHQVCFLRLMEDSDRETLRLLVDTSKVQEA
  WVPSQDTHHTQELLAVQGSLEVDPAQAGALVQRLCMRTPIYWARRAEGESGPLWGKARPSGWFEELGAEPLEIHG
  TLATGPRRQRLIYLCIDICFPSNICVSVCFYYLPD

• Structural information:
  • Protein Domains: (98..19-)
    (/note="BRICHOS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00255"-)
  • Interpro: IPR007084  
  • Prosite: PS50869
• Other Databases: GeneCards:  BRICD5  Malacards:  BRICD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq