• Gene id: 283677

Gene Summary

• Gene Symbol: REC114   Gene   UCSC   Ensembl
• Aliases: C15orf60, CT147
• Gene name: REC114 meiotic recombination protein
• Alternate names: meiotic recombination protein REC114, meiotic recombination protein REC114-like,
• Gene location: 15q24.1 (73443163: 73560012)     Exons: 6     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is orthologous to the mouse meiotic recombination protein REC114, which is involved in DNA double-strand break formation during meiosis. The encoded protein is conserved in most eukaryotes and was first discovered and char
• OMIM: 618421

Protein Summary

• Protein general information: Q7Z4M0  
  • Name: Meiotic recombination protein REC114
  • Length: 266  
  • Mass: 29155
• Sequence:

  MAEAGKVPLSLGLTGGEAAEWPLQRYARCIPSNTRDPPGPCLEAGTAPCPTWKVFDSNEESGYLVLTIVISGHFF
  IFQGQTLLEGFSLIGSKDWLKIVRRVDCLLFGTTIKDKSRLFRVQFSGESKEQALEHCCSCVQKLAQYITVQVPD
  GNIQELQLIPGPPRATESQGKDSAKSVPRQPGSHQHSEQQQVCVTAGTGAPDGRTSLTQLAQTLLASEELPHVYE
  QSAWGAEELGPFLRLCLMDQNFPAFVEEVEKELKKLAGLRN

• Structural information:
  • Interpro: IPR029168  
  • STRING: ENSP00000328423
• Other Databases: GeneCards:  REC114  Malacards:  REC114

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0006310	DNA recombination	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq