• Gene id: 283554

Gene Summary

• Gene Symbol: GPR137C   Gene   UCSC   Ensembl
• Aliases: TM7SF1L2
• Gene name: G protein-coupled receptor 137C
• Alternate names: integral membrane protein GPR137C, G protein-coupled receptor TM7SF1L2, transmembrane 7 superfamily member 1-like 2 protein,
• Gene location: 14q22.1 (52552835: 52637712)     Exons: 11     NC_000014.9
• OMIM: 0

Protein Summary

• Protein general information: Q8N3F9  
  • Name: Integral membrane protein GPR137C (Transmembrane 7 superfamily member 1 like 2 protein)
  • Length: 429  
  • Mass: 47075
• Sequence:

  MRVSVPGPAAAAAPAAGREPSTPGGGSGGGGAVAAASGAAVPGSVQLALSVLHALLYAALFAFAYLQLWRLLLYR
  ERRLSYQSLCLFLCLLWAALRTTLFSAAFSLSGSLPLLRPPAHLHFFPHWLLYCFPSCLQFSTLCLLNLYLAEVI
  CKVRCATELDRHKILLHLGFIMASLLFLVVNLTCAMLVHGDVPENQLKWTVFVRALINDSLFILCAISLVCYICK
  ITKMSSANVYLESKGMSLCQTVVVGSVVILLYSSRACYNLVVVTISQDTLESPFNYGWDNLSDKAHVEDISGEEY
  IVFGMVLFLWEHVPAWSVVLFFRAQRLNQNLAPAGMINSHSYSSRAYFFDNPRRYDSDDDLPRLGSSREGSLPNS
  QSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAPLLFTCSNLDLNNHHSLYVTPQN

• Structural information:
  • Interpro: IPR029723  
  • STRING: ENSP00000315106
• Other Databases: GeneCards:  GPR137C  Malacards:  GPR137C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005765	lysosomal membrane	IBA	cellular component
GO:1904263	positive regulation of TORC1 signaling	IBA	biological process
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)