• Gene id: 2835

Gene Summary

• Gene Symbol: GPR12   Gene   UCSC   Ensembl
• Aliases: GPCR12, GPCR21, PPP1R84
• Gene name: G protein-coupled receptor 12
• Alternate names: G-protein coupled receptor 12, protein phosphatase 1, regulatory subunit 84,
• Gene location: 13q12.13 (26760785: 26755199)     Exons: 2     NC_000013.11

Protein Summary

• Protein general information: P47775  
  • Name: G protein coupled receptor 12
  • Length: 334  
  • Mass: 36730
• Sequence:

  MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSL
  RAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHS
  ERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVM
  RHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVI
  YAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000599  IPR000723  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000384932
• Other Databases: GeneCards:  GPR12  Malacards:  GPR12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019222	regulation of metabolic process	IBA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0031210	phosphatidylcholine binding	IEA	molecular function
GO:0006874	cellular calcium ion homeostasis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray