• Gene id: 283420

Gene Summary

• Gene Symbol: CLEC9A   Gene   UCSC   Ensembl
• Aliases: CD370, DNGR-1, DNGR1, UNQ9341
• Gene name: C-type lectin domain containing 9A
• Alternate names: C-type lectin domain family 9 member A, HEEE9341,
• Gene location: 12p13.2 (10030681: 10066030)     Exons: 9     NC_000012.12
• Gene summary(Entrez): CLEC9A is a group V C-type lectin-like receptor (CTLR) that functions as an activation receptor and is expressed on myeloid lineage cells (Huysamen et al., 2008 [PubMed 18408006]).[supplied by OMIM, Aug 2008]
• OMIM: 147360

Protein Summary

• Protein general information: Q6UXN8  
  • Name: C type lectin domain family 9 member A (CD antigen CD370)
  • Length: 241  
  • Mass: 27324
  • Tissue specificity: In peripheral blood highly restricted on the surface of BDCA31(+) dendritic cells and on a small subset of CD14(+) and CD16(-) monocytes. {ECO
• Sequence:

  MHEEEIYTSLQWDSPAPDTYQKCLSSNKCSGACCLVMVISCVFCMGLLTASIFLGVKLLQVSTIAMQQQEKLIQQ
  ERALLNFTEWKRSCALQMKYCQAFMQNSLSSAHNSSPCPNNWIQNRESCYYVSEIWSIWHTSQENCLKEGSTLLQ
  IESKEEMDFITGSLRKIKGSYDYWVGLSQDGHSGRWLWQDGSSPSPGLLPAERSQSANQVCGYVKSNSLLSSNCS
  TWKYFICEKYALRSSV

• Structural information:
  • Protein Domains: (120..23-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR016187  IPR033992  
  • Prosite: PS00615 PS50041
  • CDD: cd03593
  • PDB: 3VPP
  • PDBsum: 3VPP
  • STRING: ENSP00000348074
• Other Databases: GeneCards:  CLEC9A  Malacards:  CLEC9A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	IBA	cellular component
GO:0006898	receptor-mediated endocytosis	IBA	biological process
GO:0050715	positive regulation of cytokine secretion	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0006898	receptor-mediated endocytosis	IDA	biological process
GO:0006898	receptor-mediated endocytosis	IDA	biological process
GO:0006898	receptor-mediated endocytosis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006898	receptor-mediated endocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray