• Gene id: 283238

Gene Summary

• Gene Symbol: SLC22A24   Gene   UCSC   Ensembl
• Aliases: NET46
• Gene name: solute carrier family 22 member 24
• Alternate names: steroid transmembrane transporter SLC22A24,
• Gene location: 11q12.3 (63144220: 63079939)     Exons: 10     NC_000011.10
• Gene summary(Entrez): SLC22A24 belongs to a large family of transmembrane proteins that function as uniporters, symporters, and antiporters to transport organic ions across cell membranes (Jacobsson et al., 2007 [PubMed 17714910]).[supplied by OMIM, Mar 2008]
• OMIM: 611698

Protein Summary

• Protein general information: Q8N4F4  
  • Name: Steroid transmembrane transporter SLC22A24 (Solute carrier family 22 member 24)
  • Length: 552  
  • Mass: 61701
  • Tissue specificity: [Isoform 1]
• Sequence:

  MGFDVLLDQVGGMGRFQICLIAFFCITNILLFPNIVLENFTAFTPSHRCWVPLLDNDTVSDNDTGTLSKDDLLRI
  SIPLDSNLRPQKCQRFIHPQWQLLHLNGTFPNTNEPDTEPCVDGWVYDRSSFLSTIVTEWDLVCESQSLKSMVQS
  LFMAGSLLGGLIYGHLSDRVGRKIICKLCFLQLAISNTCAAFAPTFLVYCILRFLAGFSTMTILGNTFILSLEWT
  LPRSRSMTIMVLLCSYSVGQMLLGGLAFAIQDWHILQLTVSTPIIVLFLSSWKMVESARWLIINNQLDEGLKELR
  RVAHINGKKNTEETLTTELVRSTMKKELDAVRIKTSIFSLFRAPKLRMRVFGLCFVRFAITVPFYGLILNLQHLG
  SNVSLFQILCGAVTFTARCVSLLTLNHMGRRISQILFTFPVGLFILVNTFLPQEMQILRVVLATLGIGSVSAASN
  SASVHHNELVPTILRSTVAGINAVSGRTGAALAPLLMTLMAYSPHLPWISYGVFPILAVPVILLLPETRDLPLPN
  TIQDVENDRKDSRNIKQEDTCMKVTQF

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000480336
• Other Databases: GeneCards:  SLC22A24  Malacards:  SLC22A24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015711	organic anion transport	IBA	biological process
GO:0035382	sterol transmembrane transport	IDA	biological process
GO:0008202	steroid metabolic process	IDA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0008202	steroid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)