• Gene id: 2829

Gene Summary

• Gene Symbol: XCR1   Gene   UCSC   Ensembl
• Aliases: CCXCR1, GPR5
• Gene name: X-C motif chemokine receptor 1
• Alternate names: chemokine XC receptor 1, G protein-coupled receptor 5, XC chemokine receptor 1, chemokine (C motif) XC receptor 1, chemokine (C motif) receptor 1, lymphotactin receptor,
• Gene location: 3p21.31 (120742679: 120684937)     Exons: 10     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a chemokine receptor belonging to the G protein-coupled receptor superfamily. The family members are characterized by the presence of 7 transmembrane domains and numerous conserved amino acids. This receptor is most clo
• OMIM: 600552

Protein Summary

• Protein general information: P46094  
  • Name: Chemokine XC receptor 1 (G protein coupled receptor 5) (Lymphotactin receptor) (XC chemokine receptor 1)
  • Length: 333  
  • Mass: 38508
• Sequence:

  MESSGNPESTTFFYYDLQSQPCENQAWVFATLATTVLYCLVFLLSLVGNSLVLWVLVKYESLESLTNIFILNLCL
  SDLVFACLLPVWISPYHWGWVLGDFLCKLLNMIFSISLYSSIFFLTIMTIHRYLSVVSPLSTLRVPTLRCRVLVT
  MAVWVASILSSILDTIFHKVLSSGCDYSELTWYLTSVYQHNLFFLLSLGIILFCYVEILRTLFRSRSKRRHRTVK
  LIFAIVVAYFLSWGPYNFTLFLQTLFRTQIIRSCEAKQQLEYALLICRNLAFSHCCFNPVLYVFVGVKFRTHLKH
  VLRQFWFCRLQAPSPASIPHSPGAFAYEGASFY

• Structural information:
  • Interpro: IPR005393  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000310405
• Other Databases: GeneCards:  XCR1  Malacards:  XCR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006935	chemotaxis	IBA	biological process
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0034097	response to cytokine	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0051209	release of sequestered calcium ion into cytosol	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Allergic rhinitis	KEGG:H01360
Allergic rhinitis	KEGG:H01360
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)