• Gene id: 2820

Gene Summary

• Gene Symbol: GPD2   Gene   UCSC   Ensembl
• Aliases: GDH2, GPDM, mGPDH
• Gene name: glycerol-3-phosphate dehydrogenase 2
• Alternate names: glycerol-3-phosphate dehydrogenase, mitochondrial, GPD-M, GPDH-M, glycerol-3-phosphate dehydrogenase 2 (mitochondrial), mitochondrial glycerophosphate dehydrogenase, mtGPD, testicular tissue protein Li 76,
• Gene location: 2q24.1 (156435289: 156586402)     Exons: 22     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene localizes to the inner mitochondrial membrane and catalyzes the conversion of glycerol-3-phosphate to dihydroxyacetone phosphate, using FAD as a cofactor. Along with GDP1, the encoded protein constitutes the glycerol phosp
• OMIM: 138430

Protein Summary

• Protein general information: P43304  
  • Name: Glycerol 3 phosphate dehydrogenase, mitochondrial (GPD M) (GPDH M) (EC 1.1.5.3) (mtGPD)
  • Length: 727  
  • Mass: 80853
• Sequence:

  MAFQKAVKGTILVGGGALATVLGLSQFAHYRRKQMNLAYVKAADCISEPVNREPPSREAQLLTLQNTSEFDILVI
  GGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVRYLQKAIMKLDIEQYRMVKEALHERANLLEI
  APHLSAPLPIMLPVYKWWQLPYYWVGIKLYDLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHND
  ARMNLAIALTAARYGAATANYMEVVSLLKKTDPQTGKVRVSGARCKDVLTGQEFDVRAKCVINATGPFTDSVRKM
  DDKDAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTDVTHHPIPSEEDINFI
  LNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNHVVDISESGLITIAGGKWTTYRSMAEDTINA
  AVKTHNLKAGPSRTVGLFLQGGKDWSPTLYIRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVR
  LVSEFPYIEAEVKYGIKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDYKKQEQLETARKFLY
  YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINVQMDENTLHEILNEVDLNK
  NGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGGL

• Structural information:
  • Protein Domains: (623..65-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (659..69-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR031656  IPR038299  IPR011992  IPR018247  IPR002048   IPR006076  IPR036188  IPR000447  
  • Prosite: PS00018 PS50222 PS00977 PS00978
  • CDD: cd00051
  • STRING: ENSP00000308610
• Other Databases: GeneCards:  GPD2  Malacards:  GPD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004368	glycerol-3-phosphate dehydrogenase (quinone) activity	IEA	molecular function
GO:0006072	glycerol-3-phosphate metabolic process	IEA	biological process
GO:0009331	glycerol-3-phosphate dehydrogenase complex	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0004368	glycerol-3-phosphate dehydrogenase (quinone) activity	TAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0004368	glycerol-3-phosphate dehydrogenase (quinone) activity	IEA	molecular function
GO:0052590	sn-glycerol-3-phosphate:ubiquinone oxidoreductase activity	IEA	molecular function
GO:0052591	sn-glycerol-3-phosphate:ubiquinone-8 oxidoreductase activity	IEA	molecular function
GO:0004368	glycerol-3-phosphate dehydrogenase (quinone) activity	TAS	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006127	glycerophosphate shuttle	TAS	biological process
GO:0006072	glycerol-3-phosphate metabolic process	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0006094	gluconeogenesis	IEA	biological process
GO:0043010	camera-type eye development	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0019563	glycerol catabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa00564	Glycerophospholipid metabolism
hsa00564	Glycerophospholipid metabolism

Diseases

Associated diseases	References
Carotid artery diseases	GAD: 17903303
Diabetes	GAD: 11243726
Involved in sperm capacitation	MIK: 20602492
Involved in sperm capacitation	MIK: 20602492
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20602492	Involved in sperm capacitation				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray