• Gene id: 280658

Gene Summary

• Gene Symbol: SSX7   Gene   UCSC   Ensembl
• Gene name: SSX family member 7
• Alternate names: protein SSX7, synovial sarcoma, X breakpoint 7,
• Gene location: Xp11.22 (52654899: 52644060)     Exons: 9     NC_000023.11
• Gene summary(Entrez): The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune respo

Protein Summary

• Protein general information: Q7RTT5  
  • Name: Protein SSX7
  • Length: 188  
  • Mass: 21591
  • Tissue specificity: Testis-specific. Expressed in a melanoma cell line. {ECO
• Sequence:

  MNGDDAFARRPRAGAQIPEKIQKSFDDIAKYFSKKEWEKMKSLEKISYVYMKRKYEAMTKLGFKATLPPFMHNTG
  ATDLQGNDFDNDRNQGNQVERPQMTFCRLQRIFPKIMPKKPAEEGNDSKGVPEASGSQNDGKHLCPPGKPSTSEK
  INKTSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE

• Structural information:
  • Protein Domains: (20..8-)
    (/note="KRAB-related-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00120"-)
  • Interpro: IPR001909  IPR036051  IPR003655  IPR028804  IPR019041  
  • Prosite: PS50806
  • STRING: ENSP00000298181
• Other Databases: GeneCards:  SSX7  Malacards:  SSX7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881