|
Gene id |
280636 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
SELENOH Gene UCSC Ensembl |
|
Aliases |
C11orf31, C17orf10, SELH |
|
Gene name |
selenoprotein H |
|
Alternate names |
selenoprotein H, |
|
Gene location |
11q12.1 (132887617: 132832355) Exons: 19 NC_000012.12
|
|
Gene summary(Entrez) |
This gene encodes a nucleolar protein, which belongs to the SelWTH family. It functions as an oxidoreductase, and has been shown to protect neurons against UVB-induced damage by inhibiting apoptotic cell death pathways, promote mitochondrial biogenesis an
|
|
OMIM |
607914 |
Protein Summary
|
| Protein general information
| Q8IZQ5
Name: Selenoprotein H (SelH)
Length: 122 Mass: 13453
|
| Sequence |
MAPRGRKRKAEAAVVAVAEKREKLANGGEGMEEATVVIEHCTSURVYGRNAAALSQALRLEAPELPVKVNPTKPR RGSFEVTLLRPDGSSAELWTGIKKGPPRKLKFPEPQEVVEELKKYLS
|
| Structural information |
|
| Other Databases |
GeneCards: SELENOH  Malacards: SELENOH |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0005794 |
Golgi apparatus
|
IBA |
cellular component |
GO:0005737 |
cytoplasm
|
IBA |
cellular component |
GO:0048856 |
anatomical structure deve lopment
|
IBA |
biological process |
GO:0003723 |
RNA binding
|
HDA |
molecular function |
|
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
| Unexplained infertility | MIK: 25753583 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 25753583 |
Unexplaine d infertil ity
|
|
|
46 (17 fertile men, 29 male pa tients)
|
Male infertility |
Microarray
|
Show abstract |
|