• Gene id: 2765

Gene Summary

• Gene Symbol: GML   Gene   UCSC   Ensembl
• Aliases: LY6DL
• Gene name: glycosylphosphatidylinositol anchored molecule like
• Alternate names: glycosyl-phosphatidylinositol-anchored molecule-like protein, GPI anchored molecule like protein, Glycosylphosphatidylinositol-anchored molecule-like protein, glycosylphosphatidylinositol anchored molecule like protein,
• Gene location: 8q24.3 (142834800: 142846850)     Exons: 18     NC_000008.11
• OMIM: 602370

Protein Summary

• Protein general information: Q99445  
  • Name: Glycosyl phosphatidylinositol anchored molecule like protein
  • Length: 158  
  • Mass: 17730
• Sequence:

  MLLFALLLAMELPLVAASATMRAQWTYSLRCHDCAVINDFNCPNIRVCPYHIRRCMTISIRINSRELLVYKNCTN
  NCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLGVSKLLLSFAS
  IIVSNILP

• Structural information:
  • Protein Domains: (29..13-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR018363  IPR016054  
  • Prosite: PS00983
  • STRING: ENSP00000220940
• Other Databases: GeneCards:  GML  Malacards:  GML

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0019898	extrinsic component of membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq