• Gene id: 27333

Gene Summary

• Gene Symbol: GOLIM4   Gene   UCSC   Ensembl
• Aliases: GIMPC, GOLPH4, GPP130, P138
• Gene name: golgi integral membrane protein 4
• Alternate names: Golgi integral membrane protein 4, 130 kDa golgi-localized phosphoprotein, cis Golgi-localized calcium-binding protein, golgi integral membrane protein, cis, golgi phosphoprotein 4, golgi phosphoprotein of 130 kDa, golgi-localized phosphoprotein of 130 kDa, type,
• Gene location: 3q26.2 (168095923: 168008671)     Exons: 17     NC_000003.12
• Gene summary(Entrez): The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reti
• OMIM: 602018

Protein Summary

• Protein general information: O00461  
  • Name: Golgi integral membrane protein 4 (Golgi integral membrane protein, cis) (GIMPc) (Golgi phosphoprotein 4) (Golgi localized phosphoprotein of 130 kDa) (Golgi phosphoprotein of 130 kDa)
  • Length: 696  
  • Mass: 81880
• Sequence:

  MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSRLEKSL
  QKERLEHKKAKEDFLVYKLEAQETLNKGRQDSNSRYSALNVQHQMLKSQHEELKKQHSDLEEEHRKQGEDFSRTF
  NDHKQKYLQLQQEKEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALA
  AAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQNHEAVPGRAE
  DTKLYAPTHKEAEFQAPPEPIQQEVERREPEEHQVEEEHRKALEEEEMEQVGQAEHLEEEHDPSPEEQDREWKEQ
  HEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQ
  QQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHE
  PREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQVREENLPDENEEQKQSNQKQENTEVEEHLVMAG
  NPDQQEDNVDEQYQEEAEEEVQEDLTEEKKRELEHNAEETYGENDENTDDKNNDGEEQEVRDDNRPKGREEHYEE
  EEEEEEDGAAVAEKSHRRAEM

• Structural information:
  • Interpro: IPR042336  
  • DIP: 61898
  • STRING: ENSP00000417354
• Other Databases: GeneCards:  GOLIM4  Malacards:  GOLIM4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005801	cis-Golgi network	TAS	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0030139	endocytic vesicle	TAS	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq