• Gene id: 27303

Gene Summary

• Gene Symbol: RBMS3   Gene   UCSC   Ensembl
• Gene name: RNA binding motif single stranded interacting protein 3
• Alternate names: RNA-binding motif, single-stranded-interacting protein 3, RNA binding motif, single stranded interacting protein, RNA-binding protein,
• Gene location: 3p24.1 (29280859: 30010394)     Exons: 6     NC_000003.12
• Gene summary(Entrez): This gene encodes an RNA-binding protein that belongs to the c-myc gene single-strand binding protein family. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1
• OMIM: 605786

Protein Summary

• Protein general information: Q6XE24  
  • Name: RNA binding motif, single stranded interacting protein 3
  • Length: 437  
  • Mass: 47840
  • Tissue specificity: Expressed in fetal brain, fetal lung, fetal liver, heart, brain, placenta, lung, liver, muscle, kidney and pancreas. {ECO
• Sequence:

  MGKRLDQPQMYPQYTYYYPHYLQTKQSYAPAPHPMAPPSPSTNSSSNNSSNNSSGEQLSKTNLYIRGLPPGTTDQ
  DLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
  MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADG
  GQKKRQNQSKYTQNGRPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQST
  SWMPHPPYVMQPTGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQ
  GTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKP

• Structural information:
  • Protein Domains: (61..13-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (140..22-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR002343  IPR012677  IPR035979  IPR034406  IPR000504  
  • Prosite: PS50102
  • CDD: cd12475
  • STRING: ENSP00000373277
• Other Databases: GeneCards:  RBMS3  Malacards:  RBMS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0045727	positive regulation of translation	IEA	biological process
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008266	poly(U) RNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0008143	poly(A) binding	IDA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0002357	defense response to tumor cell	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881