• Gene id: 27165

Gene Summary

• Gene Symbol: GLS2   Gene   UCSC   Ensembl
• Aliases: GA, GLS, LGA, hLGA
• Gene name: glutaminase 2
• Alternate names: glutaminase liver isoform, mitochondrial, L-glutamine amidohydrolase, breast cell glutaminase, glutaminase 2 (liver, mitochondrial), glutaminase I, phosphate-activated glutaminase, phosphate-dependent glutaminase,
• Gene location: 12q13.3 (56488413: 56470943)     Exons: 19     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. Originally thought to be liver-specific, this protein has been found in othe
• OMIM: 603564

Protein Summary

• Protein general information: Q9UI32  
  • Name: Glutaminase liver isoform, mitochondrial (GLS) (EC 3.5.1.2) (L glutaminase) (L glutamine amidohydrolase)
  • Length: 602  
  • Mass: 66323
  • Tissue specificity: Highly expressed in liver. Expressed in brain and pancreas. Not observed in heart, placenta, lung, skeletal muscle and kidney. Expression is significantly reduced in hepatocellular carcinomas. {ECO
• Sequence:

  MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQDHDSSESGMLSRLGDL
  LFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQESSSGGLLDRDLFRKCVSSNIVLLTQAFRK
  KFVIPDFEEFTGHVDRIFEDVKELTGGKVAAYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLT
  YAISISTLGTDYVHKFVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
  NEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESGSVMAATLANGGICPI
  TGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSHRGTSF
  CQKLVSLFNFHNYDNLRHCARKLDPRREGAEIRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHV
  AAAEGHIEVVKFLIEACKVNPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLES
  MV

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  IPR012338  IPR015868   IPR041541  
  • Prosite: PS50297 PS50088
  • PDB: 4BQM 5U0K
  • PDBsum: 4BQM 5U0K
  • STRING: ENSP00000310447
• Other Databases: GeneCards:  GLS2  Malacards:  GLS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004359	glutaminase activity	IBA	molecular function
GO:0006537	glutamate biosynthetic process	IBA	biological process
GO:0006543	glutamine catabolic process	IBA	biological process
GO:0004359	glutaminase activity	IEA	molecular function
GO:0006541	glutamine metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0004359	glutaminase activity	TAS	molecular function
GO:0005739	mitochondrion	TAS	cellular component
GO:0006520	cellular amino acid metabolic process	TAS	biological process
GO:0004359	glutaminase activity	IEA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0072593	reactive oxygen species metabolic process	IMP	biological process
GO:0042981	regulation of apoptotic process	IMP	biological process
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0008652	cellular amino acid biosynthetic process	TAS	biological process
GO:0014047	glutamate secretion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05206	MicroRNAs in cancer
hsa04724	Glutamatergic synapse
hsa04727	GABAergic synapse
hsa05230	Central carbon metabolism in cancer
hsa00250	Alanine, aspartate and glutamate metabolism
hsa04964	Proximal tubule bicarbonate reclamation
hsa00220	Arginine biosynthesis
hsa00471	D-Glutamine and D-glutamate metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray