• Gene id: 27148

Gene Summary

• Gene Symbol: STK36   Gene   UCSC   Ensembl
• Aliases: FU
• Gene name: serine/threonine kinase 36
• Alternate names: serine/threonine-protein kinase 36, fused homolog, testicular tissue protein Li 188,
• Gene location: 2q35 (12196187: 12250588)     Exons: 13     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the serine/threonine kinase family of enzymes. This family member is similar to a Drosophila protein that plays a key role in the Hedgehog signaling pathway. This human protein is a positive regulator of the GLI zinc-finger t
• OMIM: 607652

Protein Summary

• Protein general information: Q9NRP7  
  • Name: Serine/threonine protein kinase 36 (EC 2.7.11.1) (Fused homolog)
  • Length: 1315  
  • Mass: 143995
  • Tissue specificity: Expressed at low levels in most fetal tissues, adult ovaries and at high levels in adult testis, where it is localized in germ cells. {ECO
• Sequence:

  MEKYHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLRHPNIVHMLDSFETDKE
  VVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHRILHRDMKPQNILLAKGGGIKLCDFGFARAM
  STNTMVLTSIKGTPLYMSPELVEERPYDHTADLWSVGCILYELAVGTPPFYATSIFQLVSLILKDPVRWPSTISP
  CFKNFLQGLLTKDPRQRLSWPDLLYHPFIAGHVTIITEPAGPDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSR
  ILTQAYKRMAEEAMQKKHQNTGPALEQEDKTSKVAPGTAPLPRLGATPQESSLLAGILASELKSSWAKSGTGEVP
  SAPRENRTTPDCERAFPEERPEVLGQRSTDVVDLENEEPDSDNEWQHLLETTEPVPIQLKAPLTLLCNPDFCQRI
  QSQLHEAGGQILKGILEGASHILPAFRVLSSLLSSCSDSVALYSFCREAGLPGLLLSLLRHSQESNSLQQQSWYG
  TFLQDLMAVIQAYFACTFNLERSQTSDSLQVFQEAANLFLDLLGKLLAQPDDSEQTLRRDSLMCFTVLCEAMDGN
  SRAISKAFYSSLLTTQQVVLDGLLHGLTVPQLPVHTPQGAPQVSQPLREQSEDIPGAISSALAAICTAPVGLPDC
  WDAKEQVCWHLANQLTEDSSQLRPSLISGLQHPILCLHLLKVLYSCCLVSEGLCRLLGQEPLALESLFMLIQGKV
  KVVDWEESTEVTLYFLSLLVFRLQNLPCGMEKLGSDVATLFTHSHVVSLVSAAACLLGQLGQQGVTFDLQPMEWM
  AAATHALSAPAEVRLTPPGSCGFYDGLLILLLQLLTEQGKASLIRDMSSSEMWTVLWHRFSMVLRLPEEASAQEG
  ELSLSSPPSPEPDWTLISPQGMAALLSLAMATFTQEPQLCLSCLSQHGSILMSILKHLLCPSFLNQLRQAPHGSE
  FLPVVVLSVCQLLCFPFALDMDADLLIGVLADLRDSEVAAHLLQVCCYHLPLMQVELPISLLTRLALMDPTSLNQ
  FVNTVSASPRTIVSFLSVALLSDQPLLTSDLLSLLAHTARVLSPSHLSFIQELLAGSDESYRPLRSLLGHPENSV
  RAHTYRLLGHLLQHSMALRGALQSQSGLLSLLLLGLGDKDPVVRCSASFAVGNAAYQAGPLGPALAAAVPSMTQL
  LGDPQAGIRRNVASALGNLGPEGLGEELLQCEVPQRLLEMACGDPQPNVKEAALIALRSLQQEPGIHQVLVSLGA
  SEKLSLLSLGNQSLPHSSPRPASAKHCRKLIHLLRPAHSM

• Structural information:
  • Protein Domains: (4..25-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011989  IPR016024  IPR011009  IPR000719  IPR017441   IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • STRING: ENSP00000295709
• Other Databases: GeneCards:  STK36  Malacards:  STK36

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007228	positive regulation of hh target transcription factor activity	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0060271	cilium assembly	ISS	biological process
GO:0007228	positive regulation of hh target transcription factor activity	ISS	biological process
GO:0045880	positive regulation of smoothened signaling pathway	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0030030	cell projection organization	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003351	epithelial cilium movement involved in extracellular fluid movement	IEA	biological process
GO:0007228	positive regulation of hh target transcription factor activity	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0060271	cilium assembly	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0045880	positive regulation of smoothened signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0051090	regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0008134	transcription factor binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005524	ATP binding	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0009791	post-embryonic development	ISS	biological process
GO:0006468	protein phosphorylation	TAS	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R