• Gene id: 2710

Gene Summary

• Gene Symbol: GK   Gene   UCSC   Ensembl
• Aliases: GK1, GKD
• Gene name: glycerol kinase
• Alternate names: glycerol kinase, ATP:glycerol 3-phosphotransferase, glycerokinase,
• Gene location: Xp21.2 (30653347: 30731461)     Exons: 24     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in
• OMIM: 300474

Protein Summary

• Protein general information: P32189  
  • Name: Glycerol kinase (GK) (Glycerokinase) (EC 2.7.1.30) (ATP:glycerol 3 phosphotransferase)
  • Length: 559  
  • Mass: 61245
  • Tissue specificity: Highly expressed in the liver, kidney and testis. Isoform 2 and isoform 3 are expressed specifically in testis and fetal liver, but not in the adult liver.
• Sequence:

  MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKL
  GQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFS
  AVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGI
  PMEILPNVRSSSEIYGLMKISHSVKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCV
  FSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYA
  PYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYI
  PVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSP
  ESGDPSIFCSLPLGFFIVSSMVMLIGARYISGIP

• Structural information:
  • Interpro: IPR000577  IPR018485  IPR018483  IPR018484  IPR042018   IPR005999  
  • Prosite: PS00933 PS00445
  • CDD: cd07792
  • STRING: ENSP00000401720
• Other Databases: GeneCards:  GK  Malacards:  GK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0006641	triglyceride metabolic process	IBA	biological process
GO:0016310	phosphorylation	IBA	biological process
GO:0016773	phosphotransferase activity, alcohol group as acceptor	IBA	molecular function
GO:0004370	glycerol kinase activity	IBA	molecular function
GO:0006071	glycerol metabolic process	IBA	biological process
GO:0046167	glycerol-3-phosphate biosynthetic process	IBA	biological process
GO:0004370	glycerol kinase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0006072	glycerol-3-phosphate metabolic process	IEA	biological process
GO:0016773	phosphotransferase activity, alcohol group as acceptor	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0006071	glycerol metabolic process	IEA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004370	glycerol kinase activity	IEA	molecular function
GO:0019432	triglyceride biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004370	glycerol kinase activity	IMP	molecular function
GO:0006071	glycerol metabolic process	IMP	biological process
GO:0046167	glycerol-3-phosphate biosynthetic process	IMP	biological process
GO:0006641	triglyceride metabolic process	IMP	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0019563	glycerol catabolic process	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0004370	glycerol kinase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa03320	PPAR signaling pathway
hsa00561	Glycerolipid metabolism

Diseases

Associated diseases	References
Glycerol kinase deficiency	KEGG:H02013
Glycerol kinase deficiency	KEGG:H02013
Glycerol kinase deficiency	PMID:9719371
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray