• Gene id: 27036

Gene Summary

• Gene Symbol: SIGLEC7   Gene   UCSC   Ensembl
• Aliases: AIRM1, CD328, CDw328, D-siglec, QA79, SIGLEC-7, SIGLEC19P, SIGLECP2, p75, p75/AIRM1
• Gene name: sialic acid binding Ig like lectin 7
• Alternate names: sialic acid-binding Ig-like lectin 7, AIRM-1, QA79 membrane protein, adhesion inhibitory receptor molecule 1, siglec-7, sialic acid binding immunoglobulin-like lectin 7,
• Gene location: 19q13.41 (51142259: 51153525)     Exons: 7     NC_000019.10
• OMIM: 604410

Protein Summary

• Protein general information: Q9Y286  
  • Name: Sialic acid binding Ig like lectin 7 (Siglec 7) (Adhesion inhibitory receptor molecule 1) (AIRM 1) (CDw328) (D siglec) (QA79 membrane protein) (p75) (CD antigen CD328)
  • Length: 467  
  • Mass: 51143
  • Tissue specificity: Predominantly expressed by resting and activated natural killer cells and at lower levels by granulocytes and monocytes. High expression found in placenta, liver, lung, spleen, and peripheral blood leukocytes.
• Sequence:

  MLLLLLLPLLWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGNDISWK
  APVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVTALTHRP
  NILIPGTLESGCFQNLTCSVPWACEQGTPPMISWMGTSVSPLHPSTTRSSVLTLIPQPQHHGTSLTCQVTLPGAG
  VTTNRTIQLNVSYPPQNLTVTVFQGEGTASTALGNSSSLSVLEGQSLRLVCAVDSNPPARLSWTWRSLTLYPSQP
  SNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQEYTGKMRPVSGVLLGAVGGAGATALVFLSFCVIFIV
  VRSCRKKSARPAADVGDIGMKDANTIRGSASQGNLTESWADDNPRHHGLAAHSSGEEREIQYAPLSFHKGEPQDL
  SGQEATNNEYSEIKIPK

• Structural information:
  • Protein Domains: (39..12-)
    (/note="Ig-like-V-type)
    (150..23-)
    1 (/note="Ig-like-C2-type)
    (240..33-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  
  • Prosite: PS50835
  • PDB: 1NKO 1O7S 1O7V 2DF3 2G5R 2HRL
  • PDBsum: 1NKO 1O7S 1O7V 2DF3 2G5R 2HRL
  • STRING: ENSP00000323328
• Other Databases: GeneCards:  SIGLEC7  Malacards:  SIGLEC7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0007155	cell adhesion	IBA	biological process
GO:0033691	sialic acid binding	IBA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030246	carbohydrate binding	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq