• Gene id: 27000

Gene Summary

• Gene Symbol: DNAJC2   Gene   UCSC   Ensembl
• Aliases: MPHOSPH11, MPP11, ZRF1, ZUO1
• Gene name: DnaJ heat shock protein family (Hsp40) member C2
• Alternate names: dnaJ homolog subfamily C member 2, DnaJ (Hsp40) homolog, subfamily C, member 2, M-phase phosphoprotein 11, zuotin-related factor 1,
• Gene location: 7q22.1 (103344872: 103312288)     Exons: 3     NC_000007.14
• Gene summary(Entrez): This gene is a member of the M-phase phosphoprotein (MPP) family. The gene encodes a phosphoprotein with a J domain and a Myb DNA-binding domain which localizes to both the nucleus and the cytosol. The protein is capable of forming a heterodimeric complex
• OMIM: 605502

Protein Summary

• Protein general information: Q99543  
  • Name: DnaJ homolog subfamily C member 2 (M phase phosphoprotein 11) (Zuotin related factor 1) [Cleaved into: DnaJ homolog subfamily C member 2, N terminally processed]
  • Length: 621  
  • Mass: 71996
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDEELQLEEFPM
  LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSD
  PVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFTPVFERNSRWSNKKNVPKLGDMNSSFEDVDIFYSFWYNFDSWR
  EFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAE
  AKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKTWNHFSDNEAERVK
  MMEEVEKLCDRLELASLQCLNETLTSCTKEVGKAALEKQIEEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNG
  SKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKF
  KKEHGVVPQADNATPSERFEGPYTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRYKELV
  EMVKAKKAAQEQVLNASRAKK

• Structural information:
  • Protein Domains: (88..16-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286-)
    (449..51-)
    (/note="SANT-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00624-)
    (549..60-)
    (/note="SANT-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00624"-)
  • Interpro: IPR001623  IPR018253  IPR009057  IPR036869  IPR032003   IPR042569  IPR001005  IPR017884  
  • Prosite: PS00636 PS50076 PS51293
  • CDD: cd06257 cd00167
  • PDB: 2M2E 6CGH
  • PDBsum: 2M2E 6CGH
  • DIP: 60462
  • STRING: ENSP00000368565
• Other Databases: GeneCards:  DNAJC2  Malacards:  DNAJC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0061649	ubiquitin modification-dependent histone binding	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0051083	'de novo' cotranslational protein folding	TAS	biological process
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:2000279	negative regulation of DNA biosynthetic process	IEA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray