• Gene id: 26872

Gene Summary

• Gene Symbol: STEAP1   Gene   UCSC   Ensembl
• Aliases: PRSS24, STEAP
• Gene name: STEAP family member 1
• Alternate names: metalloreductase STEAP1, STEAP1 metalloreductase, six transmembrane epithelial antigen of the prostate 1, six-transmembrane epithelial antigen of prostate 1,
• Gene location: 7q21.13 (90154468: 90164826)     Exons: 5     NC_000007.14
• Gene summary(Entrez): This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at c
• OMIM: 300289300744300745

Protein Summary

• Protein general information: Q9UHE8  
  • Name: Metalloreductase STEAP1 (EC 1.16.1. ) (Six transmembrane epithelial antigen of prostate 1)
  • Length: 339  
  • Mass: 39851
  • Tissue specificity: Ubiquitously expressed. Highly expressed in prostate tumors. {ECO
• Sequence:

  MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPI
  KIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKF
  PHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIV
  GLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIV
  VLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

• Structural information:
  • Protein Domains: (118..26-)
    (/note="Ferric-oxidoreductase")
  • Interpro: IPR013130  
  • STRING: ENSP00000297205
• Other Databases: GeneCards:  STEAP1  Malacards:  STEAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005768	endosome	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0005215	transporter activity	TAS	molecular function
GO:0015267	channel activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005911	cell-cell junction	TAS	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04978	Mineral absorption

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray