Search Result
| Gene id | 26716 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | OR2H1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | 6M1-16, HS6M1-16, OLFR42A-9004-14, OLFR42A-9004.14/9026.2, OR2H6, OR2H8, OR6-2, dJ994E9.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | olfactory receptor family 2 subfamily H member 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | olfactory receptor 2H1, olfactory receptor 2H6, olfactory receptor 2H8, olfactory receptor 6-2, olfactory receptor OR6-32, olfactory receptor, family 2, subfamily H, member 6, olfactory receptor, family 2, subfamily H, member 8, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
6p22.1 (124973294: 124979388) Exons: 3 NC_000008.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9GZK4 Name: Olfactory receptor 2H1 (Hs6M1 16) (OLFR42A 9004.14/9026.2) (Olfactory receptor 2H6) (Olfactory receptor 2H8) (Olfactory receptor 6 2) (OR6 2) (Olfactory receptor OR6 32) Length: 316 Mass: 35339 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MVNQSSPMGFLLLGFSEHPALERTLFVVVFTSYLLTLVGNTLIILLSVLYPRLHSPMYFFLSDLSFLDLCFTTSC VPQMLVNLWGPKKTISFLGCSVQLFIFLSLGTTECILLTVMAFDRYVAVCQPLHYATIIHPRLCWQLASVAWVMS LVQSIVQTPSTLHLPFCPHQQIDDFLCEVPSLIRLSCGDTSYNEIQLAVSSVIFVVVPLSLILASYGATAQAVLR INSATAWRKAFGTCSSHLTVVTLFYSSVIAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALR RLLGKERDSRESWRAA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: OR2H1  Malacards: OR2H1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||