• Gene id: 266629

Gene Summary

• Gene Symbol: SEC14L3   Gene   UCSC   Ensembl
• Aliases: TAP2
• Gene name: SEC14 like lipid binding 3
• Alternate names: SEC14-like protein 3, SEC14-like 3, SEC14p-like protein TAP2, tocopherol-associated protein 2,
• Gene location: 22q12.2 (30472016: 30447660)     Exons: 15     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thu
• OMIM: 612824

Protein Summary

• Protein general information: Q9UDX4  
  • Name: SEC14 like protein 3 (Tocopherol associated protein 2)
  • Length: 400  
  • Mass: 46048
• Sequence:

  MSGRVGDLSPKQAETLAKFRENVQDVLPALPNPDDYFLLRWLRARNFDLQKSEALLRKYMEFRKTMDIDHILDWQ
  PPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKTKMRDCERILHECDLQTERLGKKIETIV
  MIFDCEGLGLKHFWKPLVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWK
  EGLLKLISPEELPAQFGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQINRGSSHQVEYEILFPG
  CVLRWQFSSDGADIGFGVFLKTKMGERQRAGEMTDVLPSQRYNAHMVPEDGNLTCSEAGVYVLRFDNTYSFVHAK
  KVSFTVEVLLPDEGMQKYDKELTPV

• Structural information:
  • Protein Domains: (76..24-)
    (/note="CRAL-TRIO-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00056-)
    (275..38-)
    (/note="GOLD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00096"-)
  • Interpro: IPR001251  IPR036865  IPR011074  IPR036273  IPR009038   IPR036598  
  • Prosite: PS50191 PS50866
  • CDD: cd00170
  • PDB: 4UYB
  • PDBsum: 4UYB
  • STRING: ENSP00000215812
• Other Databases: GeneCards:  SEC14L3  Malacards:  SEC14L3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IEA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)