• Gene id: 26586

Gene Summary

• Gene Symbol: CKAP2   Gene   UCSC   Ensembl
• Aliases: LB1, TMAP, se20-10
• Gene name: cytoskeleton associated protein 2
• Alternate names: cytoskeleton-associated protein 2, CTCL tumor antigen se20-10, tumor- and microtubule-associated protein, tumor-associated microtubule-associated protein,
• Gene location: 13q14.3 (52455359: 52476630)     Exons: 45     NC_000013.11
• Gene summary(Entrez): This gene encodes a cytoskeleton-associated protein that stabalizes microtubules and plays a role in the regulation of cell division. The encoded protein is itself regulated through phosphorylation at multiple serine and threonine residues. There is a pse
• OMIM: 611569

Protein Summary

• Protein general information: Q8WWK9  
  • Name: Cytoskeleton associated protein 2 (CTCL tumor antigen se20 10) (Tumor and microtubule associated protein)
  • Length: 683  
  • Mass: 76987
  • Tissue specificity: Abundant in testis, thymus, and in tumor derived cell lines, while barely detectable in liver, prostate, and kidney. {ECO
• Sequence:

  MSTPAVPQDLQLPPSQRAQSAFKEQRRQKLKEHLLRRKTLFAYKQENEMLSSSRDQRVVTSEDQVQEGTKVLKLK
  TKMADKENMKRPAESKNNTVVGKHCIPLKPSNELTNSTVVIDTHKPKDSNQTPHLLLTEDDPQSQHMTLSQAFHL
  KNNSKKKQMTTEKQKQDANMPKKPVLGSYRGQIVQSKINSFRKPLQVKDESSAATKKLSATIPKATKPQPVNTSS
  VTVKSNRSSNMTATTKFVSTTSQNTQLVRPPIRSHHSNTRDTVKQGISRTSANVTIRKGPHEKELLQSKTALSSV
  KTSSSQGIIRNKTLSRSIASEVIARPASLSNDKLMEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWK
  AGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFTEKVNNTFSECLNLINEGCPKEDILVTLNDL
  IKNIPDAKKLVKYWICLALIEPITSPIENIIAIYEKAILAGAQPIEEMRHTIVDILTMKSQEKANLGENMEKSCA
  SKEEVKEVSIEDTGVDVDPEKLEMESKLHRNLLFQDCEKEQDNKTKDPTHDVKTPNTETRTSCLIKYNVSTTPYL
  QSVKKKVQFDGTNSAFKELKFLTPVRRSRRLQEKTSKLPDMLKDHYPCVSSLEQLTELGRETDAFVCRPNAALCR
  VYYEADTT

• Structural information:
  • Interpro: IPR029197  IPR026165  
  • STRING: ENSP00000367276
• Other Databases: GeneCards:  CKAP2  Malacards:  CKAP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IDA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	colocalizes with
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0000281	mitotic cytokinesis	IGI	biological process
GO:0005881	cytoplasmic microtubule	IEA	cellular component
GO:0007026	negative regulation of microtubule depolymerization	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray