• Gene id: 26579

Gene Summary

• Gene Symbol: MYEOV   Gene   UCSC   Ensembl
• Aliases: OCIM
• Gene name: myeloma overexpressed
• Alternate names: myeloma-overexpressed gene protein, myeloma overexpressed (in a subset of t(11;14) positive multiple myelomas), myeloma overexpressed gene (in a subset of t(11;14) positive multiple myelomas), oncogene in multiple myeloma,
• Gene location: 11q13.3 (69294154: 69297286)     Exons: 8     NC_000011.10
• OMIM: 605625

Protein Summary

• Protein general information: Q96EZ4  
  • Name: Myeloma overexpressed gene protein (Oncogene in multiple myeloma)
  • Length: 313  
  • Mass: 33556
• Sequence:

  MALRICVTYTPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMFTRQAGHFVEGSKAGR
  SRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAGLSQEAEDVDVSRARRVTDAPQGTLCGTGNR
  NSGSQSARVVGVAHLGEAFRVGVEQAISSCPEEVHGRHGLSMEIMWARMDVALRSPGRGLLAGAGALCMTLAESS
  CPDYERGRRACLTLHRHPTPHCSTWGLPLRVAGSWLTVVTVEALGGWRMGVRRTGQVGPTMHPPPVSGASPLLLH
  HLLLLLLIIILTC

• Structural information:
  • STRING: ENSP00000308330
• Other Databases: GeneCards:  MYEOV  Malacards:  MYEOV

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)