• Gene id: 26578

Gene Summary

• Gene Symbol: OSTF1   Gene   UCSC   Ensembl
• Aliases: OSF, SH3P2, bA235O14.1
• Gene name: osteoclast stimulating factor 1
• Alternate names: osteoclast-stimulating factor 1,
• Gene location: 9q21.13 (75088479: 75147264)     Exons: 11     NC_000009.12
• Gene summary(Entrez): Osteoclast-stimulating factor-1 is an intracellular protein produced by osteoclasts that indirectly induces osteoclast formation and bone resorption (Reddy et al., 1998 [PubMed 10092216]).[supplied by OMIM, Mar 2008]
• OMIM: 610180

Protein Summary

• Protein general information: Q92882  
  • Name: Osteoclast stimulating factor 1
  • Length: 214  
  • Mass: 23787
  • Tissue specificity: Ubiquitously expressed. Present in osteoclasts (at protein level). {ECO
• Sequence:

  MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQAESIDN
  PLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKDIVEMLFTQPNIELNQQNKLGDTALHAAAWK
  GYADIVQLLLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDAVRTLSNAEDYLDDEDSD

• Structural information:
  • Protein Domains: (12..7-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR002110  IPR020683  IPR036770  IPR036028  IPR001452  
  • Prosite: PS50297 PS50088 PS50002
  • PDB: 1X2K 1ZLM 3EHQ 3EHR
  • PDBsum: 1X2K 1ZLM 3EHQ 3EHR
  • STRING: ENSP00000340836
• Other Databases: GeneCards:  OSTF1  Malacards:  OSTF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0001503	ossification	TAS	biological process
GO:0005622	intracellular	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0005576	extracellular region	HDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)