• Gene id: 26526

Gene Summary

• Gene Symbol: TSPAN16   Gene   UCSC   Ensembl
• Aliases: TM-8, TM4-B, TM4SF16
• Gene name: tetraspanin 16
• Alternate names: tetraspanin-16, tetraspanin TM4-B, transmembrane 4 superfamily member 16, tspan-16,
• Gene location: 19p13.2 (11296143: 11326995)     Exons: 1     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate
• OMIM: 617580

Protein Summary

• Protein general information: Q9UKR8  
  • Name: Tetraspanin 16 (Tspan 16) (Tetraspanin TM4 B) (Transmembrane 4 superfamily member 16)
  • Length: 245  
  • Mass: 26266
  • Tissue specificity: Broadly expressed in most human tissues and cell lines including neural and bone marrow derived tissues.
• Sequence:

  MAEIHTPYSSLKKLLSLLNGFVAVSGIILVGLGIGGKCGGASLTNVLGLSSAYLLHVGNLCLVMGCITVLLGCAG
  WYGATKESRGTLLFCILSMVIVLIMEVTAATVVLLFFPIVGDVALEHTFVTLRKNYRGYNEPDDYSTQWNLVMEK
  LKCCGVNNYTDFSGSSFEMTTGHTYPRSCCKSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQSFTLSGSSLGA
  AVIQRWGSRYVAQAGLELLA

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR008952  
  • STRING: ENSP00000319486
• Other Databases: GeneCards:  TSPAN16  Malacards:  TSPAN16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq