• Gene id: 26502

Gene Summary

• Gene Symbol: NARF   Gene   UCSC   Ensembl
• Aliases: IOP2
• Gene name: nuclear prelamin A recognition factor
• Alternate names: nuclear prelamin A recognition factor, iron-only hydrogenase-like protein 2, prenyl-dependent prelamin A binding protein,
• Gene location: 17q25.3 (82458197: 82490536)     Exons: 16     NC_000017.11
• Gene summary(Entrez): Several proteins have been found to be prenylated and methylated at their carboxyl-terminal ends. Prenylation was initially believed to be important only for membrane attachment. However, another role for prenylation appears to be its importance in protei
• OMIM: 605349

Protein Summary

• Protein general information: Q9UHQ1  
  • Name: Nuclear prelamin A recognition factor (Iron only hydrogenase like protein 2) (IOP2)
  • Length: 456  
  • Mass: 51156
  • Tissue specificity: Ubiquitous. Predominantly expressed in skeletal muscle, heart and brain. {ECO
• Sequence:

  MKCEHCTRKECSKKTKTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKD
  FFRVLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTDASRRLCGFLKSLGVHYVFDTTIAADFSILESQKE
  FVRRYRQHSEEERTLPMLTSACPGWVRYAERVLGRPITAHLCTAKSPQQVMGSLVKDYFARQQNLSPEKIFHVIV
  APCYDKKLEALQESLPPALHGSRGADCVLTSGEIAQIMEQGDLSVRDAAVDTLFGDLKEDKVTRHDGASSDGHLA
  HIFRHAAKELFNEDVEEVTYRALRNKDFQEVTLEKNGEVVLRFAAAYGFRNIQNMILKLKKGKFPFHFVEVLACA
  GGCLNGRGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQELYQEWLEGINSPKAREVLHTTYQSQERGTH
  SLDIKW

• Structural information:
  • Interpro: IPR009016  IPR004108  IPR003149  
  • STRING: ENSP00000309899
• Other Databases: GeneCards:  NARF  Malacards:  NARF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005521	lamin binding	IPI	molecular function
GO:0005638	lamin filament	IDA	cellular component
GO:0031981	nuclear lumen	IDA	cellular component
GO:0005521	lamin binding	IBA	molecular function
GO:0005638	lamin filament	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005652	nuclear lamina	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray