• Gene id: 26271

Gene Summary

• Gene Symbol: FBXO5   Gene   UCSC   Ensembl
• Aliases: EMI1, FBX5, Fbxo31
• Gene name: F-box protein 5
• Alternate names: F-box only protein 5, F-box protein Fbx5, early mitotic inhibitor 1,
• Gene location: 6q25.2 (178480453: 178516462)     Exons: 9     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
• OMIM: 606013

Protein Summary

• Protein general information: Q9UKT4  
  • Name: F box only protein 5 (Early mitotic inhibitor 1)
  • Length: 447  
  • Mass: 50146
• Sequence:

  MSRRPCSCALRPPRCSCSASPSAVTAAGRPRPSDSCKEESSTLSVKMKCDFNCNHVHSGLKLVKPDDIGRLVSYT
  PAYLEGSCKDCIKDYERLSCIGSPIVSPRIVQLETESKRLHNKENQHVQQTLNSTNEIEALETSRLYEDSGYSSF
  SLQSGLSEHEEGSLLEENFGDSLQSCLLQIQSPDQYPNKNLLPVLHFEKVVCSTLKKNAKRNPKVDREMLKEIIA
  RGNFRLQNIIGRKMGLECVDILSELFRRGLRHVLATILAQLSDMDLINVSKVSTTWKKILEDDKGAFQLYSKAIQ
  RVTENNNKFSPHASTREYVMFRTPLASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL
  KACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSKKNLRRL

• Structural information:
  • Protein Domains: (250..29-)
    (/note="F-box"-)
  • Interpro: IPR001810  
  • Prosite: PS51872
  • PDB: 2M6N 4UI9
  • PDBsum: 2M6N 4UI9
  • DIP: 38023
  • STRING: ENSP00000229758
• Other Databases: GeneCards:  FBXO5  Malacards:  FBXO5

KEGG pathways

Pathway id	Pathway name
hsa04114	Oocyte meiosis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)