• Gene id: 26269

Gene Summary

• Gene Symbol: FBXO8   Gene   UCSC   Ensembl
• Aliases: DC10, FBS, FBX8
• Gene name: F-box protein 8
• Alternate names: F-box only protein 8, F-box protein Fbx8, F-box/SEC7 protein FBS,
• Gene location: 4q34.1 (174283666: 174236657)     Exons: 7     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
• OMIM: 605649

Protein Summary

• Protein general information: Q9NRD0  
  • Name: F box only protein 8 (F box/SEC7 protein FBS)
  • Length: 319  
  • Mass: 37068
• Sequence:

  MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKARKSKEQEGFINLEMLP
  PELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCSIYNKNPPLGFSFRKLYMQLDEGSLTFNANP
  DEGVNYFMSKGILDDSPKEIAKFIFCTRTLNWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPE
  ERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNIS
  EDFVGHLYDNIYLIGHVAA

• Structural information:
  • Protein Domains: (68..11-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080-)
    (146..27-)
    (/note="SEC7-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00189"-)
  • Interpro: IPR036047  IPR001810  IPR023394  IPR000904  IPR035999  
  • Prosite: PS50181 PS50190
  • CDD: cd00171
  • STRING: ENSP00000377280
• Other Databases: GeneCards:  FBXO8  Malacards:  FBXO8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005086	ARF guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0032012	regulation of ARF protein signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0000151	ubiquitin ligase complex	IEA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	NAS	biological process
GO:0000151	ubiquitin ligase complex	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881