• Gene id: 26263

Gene Summary

• Gene Symbol: FBXO22   Gene   UCSC   Ensembl
• Aliases: FBX22, FISTC1
• Gene name: F-box protein 22
• Alternate names: F-box only protein 22, F-box protein FBX22p44, FIST domain containing 1,
• Gene location: 15q24.2 (75903858: 75942510)     Exons: 8     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
• OMIM: 609096

Protein Summary

• Protein general information: Q8NEZ5  
  • Name: F box only protein 22 (F box protein FBX22p44)
  • Length: 403  
  • Mass: 44508
  • Tissue specificity: Predominantly expressed in liver, also enriched in cardiac muscle. {ECO
• Sequence:

  MEPVGCCGECRGSSVDPRSTFVLSNLAEVVERVLTFLPAKALLRVACVCRLWRECVRRVLRTHRSVTWISAGLAE
  AGHLEGHCLVRVVAEELENVRILPHTVLYMADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVT
  PGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGY
  NCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEK
  TAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNFIL
  RKCNEVKDDDLFHSYTTIMALIHLGSSK

• Structural information:
  • Protein Domains: (21..6-)
    (/note="F-box"-)
  • Interpro: IPR036047  IPR001810  IPR019494  
  • STRING: ENSP00000307833
• Other Databases: GeneCards:  FBXO22  Malacards:  FBXO22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0048742	regulation of skeletal muscle fiber development	IBA	biological process
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0006464	cellular protein modification process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048742	regulation of skeletal muscle fiber development	IEA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0010830	regulation of myotube differentiation	IEA	biological process
GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0009267	cellular response to starvation	IEA	biological process
GO:0006913	nucleocytoplasmic transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0030018	Z disc	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray