• Gene id: 26260

Gene Summary

• Gene Symbol: FBXO25   Gene   UCSC   Ensembl
• Aliases: FBX25
• Gene name: F-box protein 25
• Alternate names: F-box only protein 25, F-box protein Fbx25,
• Gene location: 8p23.3 (406807: 477966)     Exons: 25     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w
• OMIM: 609098

Protein Summary

• Protein general information: Q8TCJ0  
  • Name: F box only protein 25
  • Length: 367  
  • Mass: 43313
  • Tissue specificity: Expressed in all brain tissue observed. {ECO
• Sequence:

  MPFLGQDWRSPGWSWIKTEDGWKRCESCSQKLERENNRCNISHSIILNSEDGEIFNNEEHEYASKKRKKDHFRND
  TNTQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFN
  ILDKIVQKVLDDHHNPRLIKDLLQDLSSTLCILIRGVGKSVLVGNINIWICRLETILAWQQQLQDLQMTKQVNNG
  LTLSDLPLHMLNNILYRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEKQFCRHLILSEKGHIEWKLMY
  FALQKHYPAKEQYGDTLHFCRHCSILFWKDYHLALLFKDSGHPCTAADPDSCFTPVSPQHFIDLFKF

• Structural information:
  • Protein Domains: (226..27-)
    (/note="F-box"-)
  • Interpro: IPR036047  IPR040394  
  • STRING: ENSP00000372274
• Other Databases: GeneCards:  FBXO25  Malacards:  FBXO25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0019005	SCF ubiquitin ligase complex	ISS	cellular component
GO:0016567	protein ubiquitination	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0000151	ubiquitin ligase complex	NAS	cellular component
GO:0016567	protein ubiquitination	NAS	biological process
GO:0004842	ubiquitin-protein transferase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04068	FoxO signaling pathway

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R