• Gene id: 26259

Gene Summary

• Gene Symbol: FBXW8   Gene   UCSC   Ensembl
• Aliases: FBW6, FBW8, FBX29, FBXO29, FBXW6
• Gene name: F-box and WD repeat domain containing 8
• Alternate names: F-box/WD repeat-containing protein 8, F-box and WD-40 domain protein 8, F-box and WD-40 domain-containing protein 8, F-box only protein 29,
• Gene location: 12q24.22 (116910948: 117032497)     Exons: 16     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cul
• OMIM: 600076

Protein Summary

• Protein general information: Q8N3Y1  
  • Name: F box/WD repeat containing protein 8 (F box and WD 40 domain containing protein 8) (F box only protein 29)
  • Length: 598  
  • Mass: 67394
• Sequence:

  MDDYSLDEFRRRWQEELAQAQAPKKRRRPEAAERRARRPEVGSGRGEQASGDPALAQRLLEGAGRPPAARATRAE
  GQDVASRSRSPLAREGAGGGEQLVDQLIRDLNEMNDVPFFDIQLPYELAINIFQYLDRKELGRCAQVSKTWKVIA
  EDEVLWYRLCQQEGHLPDSSISDYSCWKLIFQECRAKEHMLRTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIA
  GYTSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWDLRTGKYPVHRFEHDA
  RIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVAVAAAGDLMYLLKAED
  SARTLLYAHGPPVTCLDVSANQVAFGVQGLGWVYEGSKILVYSLEAGRRLLKLGNVLRDFTCVNLSDSPPNLMVS
  GNMDGRVRIHDLRSGNIALSLSAHQLRVSAVQMDDWKIVSGGEEGLVSVWDYRMNQKLWEVYSGHPVQHISFSSH
  SLITANVPYQTVMRNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV

• Structural information:
  • Protein Domains: (113..15-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080"-)
  • Interpro: IPR036047  IPR001810  IPR011047  IPR015943  IPR001680   IPR019775  IPR017986  
  • Prosite: PS50181 PS00678 PS50082 PS50294
  • DIP: 37970
  • STRING: ENSP00000310686
• Other Databases: GeneCards:  FBXW8  Malacards:  FBXW8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004842	ubiquitin-protein transferase activity	IDA	contributes to
GO:1990393	3M complex	IDA	colocalizes with
GO:0016567	protein ubiquitination	IDA	biological process
GO:0008283	cell population proliferation	IDA	biological process
GO:0031467	Cul7-RING ubiquitin ligase complex	IDA	cellular component
GO:0016567	protein ubiquitination	IDA	biological process
GO:0031467	Cul7-RING ubiquitin ligase complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007030	Golgi organization	IEA	biological process
GO:1901485	positive regulation of transcription factor catabolic process	IEA	biological process
GO:0060712	spongiotrophoblast layer development	IEA	biological process
GO:0031467	Cul7-RING ubiquitin ligase complex	IEA	cellular component
GO:0019005	SCF ubiquitin ligase complex	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0050775	positive regulation of dendrite morphogenesis	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0060716	labyrinthine layer blood vessel development	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0031467	Cul7-RING ubiquitin ligase complex	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0050775	positive regulation of dendrite morphogenesis	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007030	Golgi organization	IGI	biological process
GO:0007030	Golgi organization	ISS	biological process
GO:0050775	positive regulation of dendrite morphogenesis	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq