Search Result
| Gene id | 26240 | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
| Gene Symbol | FAM50B Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
| Aliases | D6S2654E, X5L | ||||||||||||||||||||||||||||||||||||
| Gene name | family with sequence similarity 50 member B | ||||||||||||||||||||||||||||||||||||
| Alternate names | protein FAM50B, XAP5 like, XAP5-like protein, | ||||||||||||||||||||||||||||||||||||
| Gene location |
6p25.2 (3831900: 3851319) Exons: 4 NC_000006.12 |
||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene contains an intronless ORF that arose from ancestral retroposition. The encoded protein is related to a plant protein that plays a role in the circadian clock. This gene is adjacent to a differentially methylated region (DMR) and is imprinted an |
||||||||||||||||||||||||||||||||||||
| OMIM | 614686 | ||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
| Protein general information | Q9Y247 Name: Protein FAM50B (Protein XAP 5 like) Length: 325 Mass: 38,709 | ||||||||||||||||||||||||||||||||||||
| Sequence |
MAQYKGTMREAGRAMHLLKKRERQREQMEVLKQRIAEETILKSQVDKRFSAHYDAVEAELKSSTVGLVTLNDMKA RQEALVRERERQLAKRQHLEEQRLQQERQREQEQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDT SFLPDRDREEEENRLREELRQEWEAQREKVKDEEMEVTFSYWDGSGHRRTVRVRKGNTVQQFLKKALQGLRKDFL ELRSAGVEQLMFIKEDLILPHYHTFYDFIIARARGKSGPLFSFDVHDDVRLLSDATMEKDESHAGKVVLRSWYEK NKHIFPASRWEAYDPEKKWDKYTIR | ||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: FAM50B  Malacards: FAM50B | ||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||