• Gene id: 26225

Gene Summary

• Gene Symbol: ARL5A   Gene   UCSC   Ensembl
• Aliases: ARFLP5, ARL5
• Gene name: ADP ribosylation factor like GTPase 5A
• Alternate names: ADP-ribosylation factor-like protein 5A, ADP-ribosylation factor-like 5, ADP-ribosylation factor-like 5A, ADP-ribosylation factor-like protein 5,
• Gene location: 2q23.3 (151828420: 151798796)     Exons: 6     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/
• OMIM: 606839

Protein Summary

• Protein general information: Q9Y689  
  • Name: ADP ribosylation factor like protein 5A
  • Length: 179  
  • Mass: 20728
• Sequence:

  MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRS
  SWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDH
  QWHIQACCALTGEGLCQGLEWMMSRLKIR

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR006689  
  • Prosite: PS51417
  • PDB: 1Z6Y 1ZJ6 2H16 2H17
  • PDBsum: 1Z6Y 1ZJ6 2H16 2H17
  • STRING: ENSP00000295087
• Other Databases: GeneCards:  ARL5A  Malacards:  ARL5A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:1903292	protein localization to Golgi membrane	IBA	biological process
GO:0005525	GTP binding	IBA	molecular function
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:1903292	protein localization to Golgi membrane	IGI	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881