• Gene id: 26156

Gene Summary

• Gene Symbol: RSL1D1   Gene   UCSC   Ensembl
• Aliases: CSIG, L12, PBK1, UTP30
• Gene name: ribosomal L1 domain containing 1
• Alternate names: ribosomal L1 domain-containing protein 1, CATX-11, cellular senescence-inhibited gene protein,
• Gene location: 16p13.13 (11851541: 11833849)     Exons: 9     NC_000016.10

Protein Summary

• Protein general information: O76021  
  • Name: Ribosomal L1 domain containing protein 1 (CATX 11) (Cellular senescence inhibited gene protein) (Protein PBK1)
  • Length: 490  
  • Mass: 54973
  • Tissue specificity: Expressed at high intensities in the heart, skeletal muscle, and placenta. {ECO
• Sequence:

  MEDSASASLSSAAATGTSTSTPAAPTARKQLDKEQVRKAVDALLTHCKSRKNNYGLLLNENESLFLMVVLWKIPS
  KELRVRLTLPHSIRSDSEDICLFTKDEPNSTPEKTEQFYRKLLNKHGIKTVSQIISLQTLKKEYKSYEAKLRLLS
  SFDFFLTDARIRRLLPSLIGRHFYQRKKVPVSVNLLSKNLSREINDCIGGTVLNISKSGSCSAIRIGHVGMQIEH
  IIENIVAVTKGLSEKLPEKWESVKLLFVKTEKSAALPIFSSFVSNWDEATKRSLLNKKKKEARRKRRERNFEKQK
  ERKKKRQQARKTASVLSKDDVAPESGDTTVKKPESKKEQTPEHGKKKRGRGKAQVKATNESEDEIPQLVPIGKKT
  PANEKVEIQKHATGKKSPAKSPNPSTPRGKKRKALPASETPKAAESETPGKSPEKKPKIKEEAVKEKSPSLGKKD
  ARQTPKKPEAKFFTTPSKSVRKASHTPKKWPKKPKVPQST

• Structural information:
  • Interpro: IPR023674  IPR028364  IPR016095  
  • CDD: cd00403
  • STRING: ENSP00000460871
• Other Databases: GeneCards:  RSL1D1  Malacards:  RSL1D1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030686	90S preribosome	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0000470	maturation of LSU-rRNA	IBA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0042981	regulation of apoptotic process	IDA	biological process
GO:2000772	regulation of cellular senescence	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0032880	regulation of protein localization	IMP	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0001649	osteoblast differentiation	HDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq