• Gene id: 26136

Gene Summary

• Gene Symbol: TES   Gene   UCSC   Ensembl
• Aliases: TESS, TESS-2
• Gene name: testin LIM domain protein
• Alternate names: testin, testis derived transcript (3 LIM domains),
• Gene location: 7q31.2 (116210538: 116258785)     Exons: 8     NC_000007.14
• Gene summary(Entrez): Cancer-associated chromosomal changes often involve regions containing fragile sites. This gene maps to a commom fragile site on chromosome 7q31.2 designated FRA7G. This gene is similar to mouse Testin, a testosterone-responsive gene encoding a Sertoli ce
• OMIM: 606085

Protein Summary

• Protein general information: Q9UGI8  
  • Name: Testin (TESS)
  • Length: 421  
  • Mass: 47996
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTL
  IAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQL
  AKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDK
  SAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPR
  CAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRV
  TYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS

• Structural information:
  • Protein Domains: (92..19-)
    (/note="PET-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00636-)
    (234..29-)
    1 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (299..35-)
    2 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-)
  • Interpro: IPR034958  IPR034959  IPR034960  IPR010442  IPR033724   IPR027683  IPR001781  
  • Prosite: PS00478 PS50023 PS51303
  • CDD: cd09413 cd09416 cd09419 cd09829
  • PDB: 2IYB 2XQN
  • PDBsum: 2IYB 2XQN
  • STRING: ENSP00000350937
• Other Databases: GeneCards:  TES  Malacards:  TES

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032991	protein-containing complex	IDA	cellular component
GO:0008270	zinc ion binding	IDA	molecular function
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005925	focal adhesion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R