• Gene id: 26073

Gene Summary

• Gene Symbol: POLDIP2   Gene   UCSC   Ensembl
• Aliases: PDIP38, POLD4, p38
• Gene name: DNA polymerase delta interacting protein 2
• Alternate names: polymerase delta-interacting protein 2, 38 kDa DNA polymerase delta interaction protein, polymerase (DNA) delta interacting protein 2, polymerase (DNA-directed), delta interacting protein 2, polymerase delta interacting protein 38,
• Gene location: 17q11.2 (2963503: 3040759)     Exons: 23     NC_000004.12
• Gene summary(Entrez): This gene encodes a protein that interacts with the DNA polymerase delta p50 subunit, as well as with proliferating cell nuclear antigen. The encoded protein maybe play a role in the ability of the replication fork to bypass DNA lesions. Alternative splic
• OMIM: 611519

Protein Summary

• Protein general information: Q9Y2S7  
  • Name: Polymerase delta interacting protein 2 (38 kDa DNA polymerase delta interaction protein) (p38)
  • Length: 368  
  • Mass: 42033
• Sequence:

  MAACTARRALAVGSRWWSRSLTGARWPRPLCAAAGAGAFSPASTTTTRRHLSSRNRPEGKVLETVGVFEVPKQNG
  KYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKGKTHTYYQVLIDARDCPHISQRS
  QTEAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNH
  PWLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRG
  VVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKTPPSGLHW

• Structural information:
  • Protein Domains: (235..36-)
    (/note="ApaG-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00412"-)
  • Interpro: IPR007474  IPR036767  IPR011722  IPR036623  
  • Prosite: PS51087
  • STRING: ENSP00000475924
• Other Databases: GeneCards:  POLDIP2  Malacards:  POLDIP2

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)