• Gene id: 26050

Gene Summary

• Gene Symbol: SLITRK5   Gene   UCSC   Ensembl
• Aliases: LRRC11, bA364G4.2
• Gene name: SLIT and NTRK like family member 5
• Alternate names: SLIT and NTRK-like protein 5, leucine rich repeat containing 11, leucine-rich repeat-containing protein 11, slit and trk like gene 5,
• Gene location: 13q31.2 (87671231: 87679618)     Exons: 4     NC_000013.11
• Gene summary(Entrez): Members of the SLITRK family, such as SLITRK5, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins (see SLIT1; MIM 603742). Most SLITRKs, including SLITRK5, also have C-terminal regions that
• OMIM: 609680

Protein Summary

• Protein general information: O94991  
  • Name: SLIT and NTRK like protein 5 (Leucine rich repeat containing protein 11)
  • Length: 958  
  • Mass: 107486
  • Tissue specificity: Expressed predominantly in the cerebral cortex of the brain but also at low levels in the spinal cord and medulla. {ECO
• Sequence:

  MHTCCPPVTLEQDLHRKMHSWMLQTLAFAVTSLVLSCAETIDYYGEICDNACPCEEKDGILTVSCENRGIISLSE
  ISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASILHLGSNVIQDIETGAFHGLRGLRRLHLNNNKLELLRDDTFL
  GLENLEYLQVDYNYISVIEPNAFGKLHLLQVLILNDNLLSSLPNNLFRFVPLTHLDLRGNRLKLLPYVGLLQHMD
  KVVELQLEENPWNCSCELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRRLISDYEMRPQTPL
  STTGYLHTTPASVNSVATSSSAVYKPPLKPPKGTRQPNKPRVRPTSRQPSKDLGYSNYGPSIAYQTKSPVPLECP
  TACSCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENYIAVVRRTDFLEATGLDLLHLGNNRISMIQD
  RAFGDLTNLRRLYLNGNRIERLSPELFYGLQSLQYLFLQYNLIREIQSGTFDPVPNLQLLFLNNNLLQAMPSGVF
  SGLTLLRLNLRSNHFTSLPVSGVLDQLKSLIQIDLHDNPWDCTCDIVGMKLWVEQLKVGVLVDEVICKAPKKFAE
  TDMRSIKSELLCPDYSDVVVSTPTPSSIQVPARTSAVTPAVRLNSTGAPASLGAGGGASSVPLSVLILSLLLVFI
  MSVFVAAGLFVLVMKRRKKNQSDHTSTNNSDVSSFNMQYSVYGGGGGTGGHPHAHVHHRGPALPKVKTPAGHVYE
  YIPHPLGHMCKNPIYRSREGNSVEDYKDLHELKVTYSSNHHLQQQQQPPPPPQQPQQQPPPQLQLQPGEEERRES
  HHLRSPAYSVSTIEPREDLLSPVQDADRFYRGILEPDKHCSTTPAGNSLPEYPKFPCSPAAYTFSPNYDLRRPHQ
  YLHPGAGDSRLREPVLYSPPSAVFVEPNRNEYLELKAKLNVEPDYLEVLEKQTTFSQF

• Structural information:
  • Protein Domains: (235..28-)
    (/note="LRRCT-1)
    (365..40-)
    (/note="LRRNT-)
    (563..61-)
    (/note="LRRCT-2")
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • STRING: ENSP00000366283
• Other Databases: GeneCards:  SLITRK5  Malacards:  SLITRK5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007409	axonogenesis	IBA	biological process
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048813	dendrite morphogenesis	IEA	biological process
GO:0021756	striatum development	IEA	biological process
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0072358	cardiovascular system development	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0043588	skin development	IEA	biological process
GO:0030534	adult behavior	IEA	biological process
GO:0009410	response to xenobiotic stimulus	IEA	biological process
GO:0007625	grooming behavior	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq