• Gene id: 26048

Gene Summary

• Gene Symbol: ZNF500   Gene   UCSC   Ensembl
• Aliases: ZKSCAN18, ZSCAN50
• Gene name: zinc finger protein 500
• Alternate names: zinc finger protein 500, zinc finger protein with KRAB and SCAN domains 18,
• Gene location: 16p13.3 (4767218: 4745960)     Exons: 9     NC_000016.10
• OMIM: 615839

Protein Summary

• Protein general information: O60304  
  • Name: Zinc finger protein 500 (Zinc finger protein with KRAB and SCAN domains 18)
  • Length: 480  
  • Mass: 53674
• Sequence:

  MATVPGLQPLPTLEQDLEQEEILIVKVEEDFCLEEEPSVETEDPSPETFRQLFRLFCYQEVAGPREALSRLWELC
  CRWLRPELRTKEQILELLVLEQFLTVLPGEIQARVREQQPESGEEAVVLVEGLQRKPRKHRQRGSELLSDDEVPL
  GIGGQFLKHQAEAQPEDLSLEEEARFSSQQPPAQLSHRPQRGPLLWPERGPPAPRHQEMASASPFLSAWSQVPVN
  LEDVAVYLSGEEPRCMDPAQRDAPLENEGPGIQLEDGGDGREDAPLRMEWYRVLSARCQGPGHPLPGQRPAPVRG
  LVRPDQPRGGPPPGRRASHGADKPYTCPECGKGFSKTSHLTKHQRTHTGERPYKCLVCGKGFSDRSNFSTHQRVH
  TGEKPYPCPECGKRFSQSSSLVIHRRTHSGERPYACTQCGKRFNNSSHFSAHRRTHTGEKPYTCPACGRGFRRGT
  DLHKHQRTHMGAGSLPTLQPVAPGGPGAKA

• Structural information:
  • Protein Domains: (50..13-)
    (/note="SCAN-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00187-)
    (224..26-)
    (/note="KRAB"-)
  • Interpro: IPR001909  IPR036051  IPR003309  IPR038269  IPR036236   IPR013087  
  • Prosite: PS50804 PS00028 PS50157
  • CDD: cd07765 cd07936
  • STRING: ENSP00000219478
• Other Databases: GeneCards:  ZNF500  Malacards:  ZNF500

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq