• Gene id: 26045

Gene Summary

• Gene Symbol: LRRTM2   Gene   UCSC   Ensembl
• Gene name: leucine rich repeat transmembrane neuronal 2
• Alternate names: leucine-rich repeat transmembrane neuronal protein 2, leucine-rich repeat neuronal 2 protein, leucine-rich repeat transmembrane neuronal 2 protein,
• Gene location: 5q31.2 (138875334: 138868920)     Exons: 2     NC_000005.10

Protein Summary

• Protein general information: O43300  
  • Name: Leucine rich repeat transmembrane neuronal protein 2 (Leucine rich repeat neuronal 2 protein)
  • Length: 516  
  • Mass: 59076
  • Tissue specificity: Expressed in neuronal tissues. {ECO
• Sequence:

  MGLHFKWPLGAPMLAAIYAMSMVLKMLPALGMACPPKCRCEKLLFYCDSQGFHSVPNATDKGSLGLSLRHNHITE
  LERDQFASFSQLTWLHLDHNQISTVKEDAFQGLYKLKELILSSNKIFYLPNTTFTQLINLQNLDLSFNQLSSLHP
  ELFYGLRKLQTLHLRSNSLRTIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINFAHF
  LRLSSLHTLFLQWNKISNLTCGMEWTWGTLEKLDLTGNEIKAIDLTVFETMPNLKILLMDNNKLNSLDSKILNSL
  RSLTTVGLSGNLWECSARICALASWLGSFQGRWEHSILCHSPDHTQGEDILDAVHGFQLCWNLSTTVTVMATTYR
  DPTTEYTKRISSSSYHVGDKEIPTTAGIAVTTEEHFPEPDNAIFTQRVITGTMALLFSFFFIIFIVFISRKCCPP
  TLRRIRQCSMVQNHRQLRSQTRLHMSNMSDQGPYNEYEPTHEGPFIIINGYGQCKCQQLPYKECEV

• Structural information:
  • Protein Domains: (34..6-)
    (/note="LRRNT-)
    (311..36-)
    (/note="LRRCT"-)
  • Interpro: IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • PDB: 5Z8X 5Z8Y
  • PDBsum: 5Z8X 5Z8Y
  • STRING: ENSP00000274711
• Other Databases: GeneCards:  LRRTM2  Malacards:  LRRTM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002091	negative regulation of receptor internalization	IEA	biological process
GO:0050808	synapse organization	IEA	biological process
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0050808	synapse organization	IEA	biological process
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0042043	neurexin family protein binding	IEA	molecular function
GO:0060076	excitatory synapse	IEA	cellular component
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0099151	regulation of postsynaptic density assembly	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0098982	GABA-ergic synapse	IMP	cellular component
GO:0099060	integral component of postsynaptic specialization membrane	IMP	cellular component
GO:0098982	GABA-ergic synapse	IDA	cellular component
GO:0099060	integral component of postsynaptic specialization membrane	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq