• Gene id: 26022

Gene Summary

• Gene Symbol: TMEM98   Gene   UCSC   Ensembl
• Aliases: TADA1
• Gene name: transmembrane protein 98
• Alternate names: transmembrane protein 98,
• Gene location: 17q11.2 (32927909: 32944314)     Exons: 9     NC_000017.11
• Gene summary(Entrez): This gene encodes a transmembrane protein. A missense mutation in this gene result in Nanophthalmos 4 (NNO4). Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2014]
• OMIM: 615949

Protein Summary

• Protein general information: Q9Y2Y6  
  • Name: Transmembrane protein 98 (Protein TADA1)
  • Length: 226  
  • Mass: 24611
  • Tissue specificity: Widely expressed with high expression in the ovary, pancreas and prostate (PubMed
• Sequence:

  METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVITNPHIE
  AILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVDDVVKSMYPPL
  DPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPDKGLPGPEGFLQEQSA
  I

• Structural information:
  • Interpro: IPR029668  
  • STRING: ENSP00000463245
• Other Databases: GeneCards:  TMEM98  Malacards:  TMEM98

Diseases

Associated diseases	References
Nanophthalmos	KEGG:H02172
Nanophthalmos	KEGG:H02172
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881