• Gene id: 25979

Gene Summary

• Gene Symbol: DHRS7B   Gene   UCSC   Ensembl
• Aliases: CGI-93, SDR32C1
• Gene name: dehydrogenase/reductase 7B
• Alternate names: dehydrogenase/reductase SDR family member 7B, dehydrogenase/reductase (SDR family) member 7B, short-chain dehydrogenase/reductase family 32C member 1,
• Gene location: 17p11.2 (21123367: 21192029)     Exons: 10     NC_000017.11
• Gene summary(Entrez): This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function. [provided by RefSeq, Jul 2008]
• OMIM: 616160

Protein Summary

• Protein general information: Q6IAN0  
  • Name: Dehydrogenase/reductase SDR family member 7B (EC 1.1. . ) (Short chain dehydrogenase/reductase family 32C member 1)
  • Length: 325  
  • Mass: 35119
• Sequence:

  MVSPATRKSLPKVKAMDFITSTAILPLLFGCLGVFGLFRLLQWVRGKAYLRNAVVVITGATSGLGKECAKVFYAA
  GAKLVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDLTDSGAIVAAAAEILQCFGYVDILVNNAGISYRGT
  IMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISSIQGKMSIPFRSAYAASKHATQAFFDCLRAEM
  EQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAVGKKKKDVILADLLPSLAVYL
  RTLAPGLFFSLMASRARKERKSKNS

• Structural information:
  • Interpro: IPR036291  IPR020904  IPR002347  
  • Prosite: PS00061
  • STRING: ENSP00000378887
• Other Databases: GeneCards:  DHRS7B  Malacards:  DHRS7B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008611	ether lipid biosynthetic process	IBA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0030223	neutrophil differentiation	IEA	biological process
GO:0008611	ether lipid biosynthetic process	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq