• Gene id: 25960

Gene Summary

• Gene Symbol: ADGRA2   Gene   UCSC   Ensembl
• Aliases: GPR124, TEM5
• Gene name: adhesion G protein-coupled receptor A2
• Alternate names: adhesion G protein-coupled receptor A2, G-protein coupled receptor 124, tumor endothelial marker 5,
• Gene location: 8p11.23 (37796882: 37844895)     Exons: 19     NC_000008.11
• OMIM: 606823

Protein Summary

• Protein general information: Q96PE1  
  • Name: Adhesion G protein coupled receptor A2 (G protein coupled receptor 124) (Tumor endothelial marker 5)
  • Length: 1338  
  • Mass: 142647
  • Tissue specificity: Expressed in endothelial cells (at protein level) (PubMed
• Sequence:

  MGAGGRRMRGAPARLLLPLLPWLLLLLAPEARGAPGCPLSIRSCKCSGERPKGLSGGVPGPARRRVVCSGGDLPE
  PPEPGLLPNGTVTLLLSNNKITGLRNGSFLGLSLLEKLDLRNNIISTVQPGAFLGLGELKRLDLSNNRIGCLTSE
  TFQGLPRLLRLNISGNIFSSLQPGVFDELPALKVVDLGTEFLTCDCHLRWLLPWAQNRSLQLSEHTLCAYPSALH
  AQALGSLQEAQLCCEGALELHTHHLIPSLRQVVFQGDRLPFQCSASYLGNDTRIRWYHNRAPVEGDEQAGILLAE
  SLIHDCTFITSELTLSHIGVWASGEWECTVSMAQGNASKKVEIVVLETSASYCPAERVANNRGDFRWPRTLAGIT
  AYQSCLQYPFTSVPLGGGAPGTRASRRCDRAGRWEPGDYSHCLYTNDITRVLYTFVLMPINASNALTLAHQLRVY
  TAEAASFSDMMDVVYVAQMIQKFLGYVDQIKELVEVMVDMASNLMLVDEHLLWLAQREDKACSRIVGALERIGGA
  ALSPHAQHISVNARNVALEAYLIKPHSYVGLTCTAFQRREGGVPGTRPGSPGQNPPPEPEPPADQQLRFRCTTGR
  PNVSLSSFHIKNSVALASIQLPPSLFSSLPAALAPPVPPDCTLQLLVFRNGRLFHSHSNTSRPGAAGPGKRRGVA
  TPVIFAGTSGCGVGNLTEPVAVSLRHWAEGAEPVAAWWSQEGPGEAGGWTSEGCQLRSSQPNVSALHCQHLGNVA
  VLMELSAFPREVGGAGAGLHPVVYPCTALLLLCLFATIITYILNHSSIRVSRKGWHMLLNLCFHIAMTSAVFAGG
  ITLTNYQMVCQAVGITLHYSSLSTLLWMGVKARVLHKELTWRAPPPQEGDPALPTPSPMLRFYLIAGGIPLIICG
  ITAAVNIHNYRDHSPYCWLVWRPSLGAFYIPVALILLITWIYFLCAGLRLRGPLAQNPKAGNSRASLEAGEELRG
  STRLRGSGPLLSDSGSLLATGSARVGTPGPPEDGDSLYSPGVQLGALVTTHFLYLAMWACGALAVSQRWLPRVVC
  SCLYGVAASALGLFVFTHHCARRRDVRASWRACCPPASPAAPHAPPRALPAAAEDGSPVFGEGPPSLKSSPSGSS
  GHPLALGPCKLTNLQLAQSQVCEAGAAAGGEGEPEPAGTRGNLAHRHPNNVHHGRRAHKSRAKGHRAGEACGKNR
  LKALRGGAAGALELLSSESGSLHNSPTDSYLGSSRNSPGAGLQLEGEPMLTPSEGSDTSAAPLSEAGRAGQRRSA
  SRDSLKGGGALEKESHRRSYPLNAASLNGAPKGGKYDDVTLMGAEVASGGCMKTGLWKSETTV

• Structural information:
  • Protein Domains: (190..24-)
    (/note="LRRCT-)
    (/evidence="ECO:0000255-)
    (247..34-)
    (/note="Ig-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00114-)
    (707..75-)
    (/note="GPS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00098"-)
  • Interpro: IPR000483  IPR017981  IPR036445  IPR001879  IPR000832   IPR017983  IPR000203  IPR007110  IPR013783  IPR003599  IPR001611  IPR003591  IPR032675  
  • Prosite: PS00650 PS50227 PS50261 PS50221 PS50835 PS51450
  • STRING: ENSP00000406367
• Other Databases: GeneCards:  ADGRA2  Malacards:  ADGRA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002040	sprouting angiogenesis	IBA	biological process
GO:0007417	central nervous system development	IBA	biological process
GO:1990909	Wnt signalosome	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IBA	biological process
GO:1990909	Wnt signalosome	IDA	cellular component
GO:0090263	positive regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0043542	endothelial cell migration	ISS	biological process
GO:0007417	central nervous system development	ISS	biological process
GO:0002040	sprouting angiogenesis	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0090210	regulation of establishment of blood-brain barrier	ISS	biological process
GO:0050920	regulation of chemotaxis	ISS	biological process
GO:0045765	regulation of angiogenesis	ISS	biological process
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043542	endothelial cell migration	IEA	biological process
GO:0010595	positive regulation of endothelial cell migration	IEA	biological process
GO:0007417	central nervous system development	IEA	biological process
GO:0002040	sprouting angiogenesis	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0090210	regulation of establishment of blood-brain barrier	IEA	biological process
GO:0050920	regulation of chemotaxis	IEA	biological process
GO:0045765	regulation of angiogenesis	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030175	filopodium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)