• Gene id: 25940

Gene Summary

• Gene Symbol: FAM98A   Gene   UCSC   Ensembl
• Gene name: family with sequence similarity 98 member A
• Alternate names: protein FAM98A,
• Gene location: 2p22.3 (154974641: 154979250)     Exons: 3     NC_000001.11

Protein Summary

• Protein general information: Q8NCA5  
  • Name: Protein FAM98A
  • Length: 518  
  • Mass: 55273
  • Tissue specificity: Expressed strongly in colorectal cancer cells (PubMed
• Sequence:

  MECDLMETDILESLEDLGYKGPLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEF
  QLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCLLLLTYLISELEAARMLCVNAPPKKAQEGGGSEVFQELKGIC
  IALGMSKPPANITMFQFFSGIEKKLKETLAKVPPNHVGKPLLKKPMGPAHWEKIEAINQAIANEYEVRRKLLIKR
  LDVTVQSFGWSDRAKSQTEKLAKVYQPKRSVLSPKTTISVAHLLAARQDLSKILRTSSGSIREKTACAINKVLMG
  RVPDRGGRPNEIEPPPPEMPPWQKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRGGGR
  GNKHQGGWTDGGSGGGGGYQDGGYRDSGFQPGGYHGGHSSGGYQGGGYGGFQTSSSYTGSGYQGGGYQQDNRYQD
  GGHHGDRGGGRGGRGGRGGRGGRAGQGGGWGGRGSQNYHQGGQFEQHFQHGGYQYNHSGFGQGRHYTS

• Structural information:
  • Interpro: IPR018797  
  • STRING: ENSP00000238823
• Other Databases: GeneCards:  FAM98A  Malacards:  FAM98A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072669	tRNA-splicing ligase complex	IBA	cellular component
GO:0032418	lysosome localization	ISS	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0006479	protein methylation	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0008276	protein methyltransferase activity	IMP	molecular function
GO:1900029	positive regulation of ruffle assembly	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032418	lysosome localization	IEA	biological process
GO:1900029	positive regulation of ruffle assembly	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)