• Gene id: 25934

Gene Summary

• Gene Symbol: NIPSNAP3A   Gene   UCSC   Ensembl
• Aliases: HSPC299, NIPSNAP4, TASSC
• Gene name: nipsnap homolog 3A
• Alternate names: protein NipSnap homolog 3A, protein NipSnap homolog 4, target for Salmonella secreted protein C,
• Gene location: 9q31.1 (104747682: 104760119)     Exons: 6     NC_000009.12
• Gene summary(Entrez): NIPSNAP3A belongs to a family of proteins with putative roles in vesicular transport (Buechler et al., 2004 [PubMed 15177564]).[supplied by OMIM, Mar 2008]
• OMIM: 608871

Protein Summary

• Protein general information: Q9UFN0  
  • Name: Protein NipSnap homolog 3A (NipSnap3A) (Protein NipSnap homolog 4) (NipSnap4) (Target for Salmonella secreted protein C) (TassC)
  • Length: 247  
  • Mass: 28467
  • Tissue specificity: Ubiquitous. Highly expressed in liver, kidney and muscle. Expressed at intermediate level in brain, heart, colon, thymus, kidney, small intestine, placenta, lung, leukocytes and spleen. {ECO
• Sequence:

  MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELVGYWSV
  EFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKPPKEGVYELAT
  FQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGRHKSHEDPRVVAAVRE
  SVNYLVSQQNMLLIPTSFSPLK

• Structural information:
  • Interpro: IPR011008  IPR012577  
  • STRING: ENSP00000363899
• Other Databases: GeneCards:  NIPSNAP3A  Malacards:  NIPSNAP3A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881